DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and mapk10

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001305177.1 Gene:mapk10 / 779515 XenbaseID:XB-GENE-1009840 Length:497 Species:Xenopus tropicalis


Alignment Length:382 Identity:286/382 - (74%)
Similarity:321/382 - (84%) Gaps:20/382 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYR 70
            :|.|:|||||:.||:..||.||:|||||||||||||||.:..:|||||||||||||.||||||||
 Frog    46 NQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYR 110

  Fly    71 EFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDLDHDRMSYLLYQMLC 135
            |..|||.|||||||.|||.||||::||||||||||||||||||||||||:|||:|||||||||||
 Frog   111 ELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLC 175

  Fly   136 GIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGY 200
            |||||||||||||||||||||||:|||||||||||||||||:|||||||||||||||||||||||
 Frog   176 GIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY 240

  Fly   201 TENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYT 265
            .|||||||||||||||:|..:||||.|:||||||:|||||||.|.||::|||||||||||||:|.
 Frog   241 KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVENRPKYA 305

  Fly   266 GYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVD 330
            |.:|.:||||.|||.|:..| :.|||.||:||||||||||.:||||||||:|.|||||||..||:
 Frog   306 GLTFPKLFPDSLFPADSEHN-KLKASQARDLLSKMLVIDPAKRISVDEALQHPYINVWYDPSEVE 369

  Fly   331 A-------------------PAPEPYDHSVDEREHTVEQWKELIYEEVMDYEAHNTN 368
            |                   |.|:.||..:||||||:|:||||||:|||::|....|
 Frog   370 AGPLRDIWNEQPVKTKNNEKPPPQIYDKQLDEREHTIEEWKELIYKEVMNFEEKTKN 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 272/354 (77%)
mapk10NP_001305177.1 STKc_JNK 63..417 CDD:270840 272/354 (77%)
S_TKc 64..359 CDD:214567 244/295 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 506 1.000 Domainoid score I334
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 585 1.000 Inparanoid score I986
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D295851at33208
OrthoFinder 1 1.000 - - FOG0001812
OrthoInspector 1 1.000 - - otm47860
Panther 1 1.100 - - LDO PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4615
SonicParanoid 1 1.000 - - X1172
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.190

Return to query results.
Submit another query.