DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and pak2

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_002935145.1 Gene:pak2 / 733718 XenbaseID:XB-GENE-966302 Length:518 Species:Xenopus tropicalis


Alignment Length:320 Identity:82/320 - (25%)
Similarity:143/320 - (44%) Gaps:65/320 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLM 75
            |.:||..    .:|.....||.||.|.|..|.|..|.|.||||:::  .|.....:....|..:|
 Frog   234 VSIGDPK----KKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQIN--LQKQPKKELIINEILVM 292

  Fly    76 KLVNHKNIIGLLNAFTPQRNLEEFQDVYLVME-LMDANLCQVI-QMDLDHDRMSYLLYQMLCGIK 138
            |.:.:.||:..|::|...      .::|:||| |...:|..|: :..:|..:::.:..:.|..::
 Frog   293 KELKNPNIVNFLDSFLVS------DELYVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALE 351

  Fly   139 HLHSAGIIHRDLKPSNIVVKADCTLKILDFGLA------RTAGTTFMMTPYVVTRYYRAPEVILG 197
            .||:..:||||:|..|:::..|.::|:.|||..      ::..:|.:.||     |:.||||:..
 Frog   352 FLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTP-----YWMAPEVVTR 411

  Fly   198 MGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRP 262
            ..|...|||||:|.:..||:.|...:...:.: :...:|...|||.....::|.|..|::     
 Frog   412 KAYGPKVDIWSLGIMAIEMVEGEPPYLNENPL-RALYLIATNGTPELQKPEKLSPIFRDF----- 470

  Fly   263 RYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINV 322
                                              |::.|.:|.|:|.|..|.|:|.::.:
 Frog   471 ----------------------------------LNRSLEMDVEKRGSARELLQHPFLKL 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 79/308 (26%)
pak2XP_002935145.1 PBD 67..121 CDD:334253
STKc_PAK2 223..518 CDD:132986 82/320 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.