DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and MAPK6

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_002739.1 Gene:MAPK6 / 5597 HGNCID:6879 Length:721 Species:Homo sapiens


Alignment Length:391 Identity:117/391 - (29%)
Similarity:190/391 - (48%) Gaps:75/391 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKK--LSRPFQNVTHAKRAYREFKLMKLVNH 80
            |.:.|||::|:|:|.|..|:|.:|.|....:.|||||  |:.| |:|.|   |.||.|:::.::|
Human    14 FDLGSRYMDLKPLGCGGNGLVFSAVDNDCDKRVAIKKIVLTDP-QSVKH---ALREIKIIRRLDH 74

  Fly    81 KNIIGLLNAFTPQ--------RNLEEFQDVYLVMELMDANLCQVIQMD---LDHDRMSYLLYQML 134
            .||:.:.....|.        .:|.|...||:|.|.|:.:|..|::..   .:|.|:  .:||:|
Human    75 DNIVKVFEILGPSGSQLTDDVGSLTELNSVYIVQEYMETDLANVLEQGPLLEEHARL--FMYQLL 137

  Fly   135 CGIKHLHSAGIIHRDLKPSNIVVKA-DCTLKILDFGLARTAGTTFMMTPY----------VVTRY 188
            .|:|::|||.::||||||:|:.:.. |..|||.||||||      :|.|:          :||::
Human   138 RGLKYIHSANVLHRDLKPANLFINTEDLVLKIGDFGLAR------IMDPHYSHKGHLSEGLVTKW 196

  Fly   189 YRAPEVILG-MGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQP 252
            ||:|.::|. ..||:.:|:|:.|||..||:.|..||.|...::|...|:|.:........|.|..
Human   197 YRSPRLLLSPNNYTKAIDMWAAGCIFAEMLTGKTLFAGAHELEQMQLILESIPVVHEEDRQELLS 261

  Fly   253 TVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKH 317
            .:..|:.|..........:|.| |:            :.:|.:.|.::|...|..|::.:|||.|
Human   262 VIPVYIRNDMTEPHKPLTQLLP-GI------------SREALDFLEQILTFSPMDRLTAEEALSH 313

  Fly   318 EYINVWYDAEEVDAPAPEPYDHS-------------VDEREHTVEQWKELIYEEVM----DYEAH 365
            .|::::      ..|..||....             :||....:..|:.  |.:..    |:..|
Human   314 PYMSIY------SFPMDEPISSHPFHIEDEVDDILLMDETHSHIYNWER--YHDCQFSEHDWPVH 370

  Fly   366 N 366
            |
Human   371 N 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 112/373 (30%)
MAPK6NP_002739.1 STKc_MAPK4_6 14..355 CDD:143359 112/371 (30%)
SEG motif 189..191 0/1 (0%)
FRIEDE motif 332..337 0/4 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 701..721
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.