DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and Mapk4

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_062192.1 Gene:Mapk4 / 54268 RGDID:3047 Length:583 Species:Rattus norvegicus


Alignment Length:356 Identity:106/356 - (29%)
Similarity:181/356 - (50%) Gaps:46/356 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 EVGDT-----NFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYRE 71
            |.||.     .:.:..|:.:.:|:|.|..|:|.:|.|:...:.||:||:  ...:....|.|.||
  Rat     3 EKGDCIASVYGYDLGGRFTDFQPLGFGVNGLVLSATDSRACRKVAVKKI--VLSDARSMKHALRE 65

  Fly    72 FKLMKLVNHKNIIGLLNAFTP-----QRNLEEFQDVYLVMELMDANL-CQVIQMDLDHDRMSYLL 130
            .|:::.::|.||:.:.....|     |..|.:|...|:|.|.|:.:| |.:.|..|..:.....:
  Rat    66 IKIIRRLDHDNIVKVYEVLGPKGSDLQGELFKFSVAYIVQEYMETDLACLLEQGTLTEEHAKLFM 130

  Fly   131 YQMLCGIKHLHSAGIIHRDLKPSNIVVKA-DCTLKILDFGLARTAGTTFMMTPY----VVTRYYR 190
            ||:|.|:|::|||.::||||||:||.:.. |..|||.||||||.|...:....|    :||::||
  Rat   131 YQLLRGLKYIHSANVLHRDLKPANIFISTEDLVLKIGDFGLARIADQHYSHKGYLSEGLVTKWYR 195

  Fly   191 APEVILG-MGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTV 254
            :|.::|. ..||:.:|:|:.|||:.||:.|.:||.|...::|...|::.:........:.|...:
  Rat   196 SPRLLLSPNNYTKAIDMWAAGCILAEMLTGKMLFAGAHELEQMQLILDTIPVVREEDKEELLRVM 260

  Fly   255 RNYVEN-----RPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEA 314
            .::|.:     ||      ..:|.||          ..|:|.|   .|.|:|..:|..|::.:..
  Rat   261 PSFVSSTWEVKRP------LRKLLPD----------VNREAID---FLEKILTFNPMDRLTAEMG 306

  Fly   315 LKHEYINVWYDAEEVDAPAPEPY--DHSVDE 343
            |:|.|::. |...|.:..:..|:  :..:|:
  Rat   307 LQHPYMSP-YSCPEDEPTSQHPFRIEDEIDD 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 103/340 (30%)
Mapk4NP_062192.1 STKc_MAPK4_6 14..351 CDD:143359 103/345 (30%)
Pkinase 20..312 CDD:278497 97/312 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.