DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and Nlk

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001178853.1 Gene:Nlk / 497961 RGDID:1561602 Length:527 Species:Rattus norvegicus


Alignment Length:397 Identity:132/397 - (33%)
Similarity:204/397 - (51%) Gaps:66/397 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAY 69
            ||.|:..:..|....        ||||.||.|:|.:..|....:.||:||:...|||:...||.:
  Rat   127 QHSHHPQQQLDIEPD--------RPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCKRVF 183

  Fly    70 REFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQVI--QMDLDHDRMSYLLYQ 132
            ||.|::....|.|::..|:...|. :::.|:::|:|.|||.::|.::|  ...|..|.:...|||
  Rat   184 RELKMLCFFKHDNVLSALDILQPP-HIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDHVKVFLYQ 247

  Fly   133 MLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLART--AGTTFMMTPYVVTRYYRAPEVI 195
            :|.|:|:||||||:|||:||.|::|.::|.|||.||||||.  ...:..||..|||:||||||::
  Rat   248 ILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEIL 312

  Fly   196 LG-MGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVE 259
            :| ..|:..:||||||||..|::...:||.....|.|.:.|.:.|||||...|:......:.::.
  Rat   313 MGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEGAKAHIL 377

  Fly   260 NRPR--------YTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALK 316
            ..|.        ||                   .|.:...:|.:||.:|||.||.:|||..:||.
  Rat   378 RGPHKQPSLPVLYT-------------------LSSQATHEAVHLLCRMLVFDPSKRISAKDALA 423

  Fly   317 HEYIN---VWY-------------------DAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEV 359
            |.|::   :.|                   |.|.|..|   .:|.:.::...:|.|.||:|::.:
  Rat   424 HPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNP---KFDDTFEKNLSSVRQVKEIIHQFI 485

  Fly   360 MDYEAHN 366
            ::.:..|
  Rat   486 LEQQKGN 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 127/370 (34%)
NlkNP_001178853.1 Required for interaction with TAB2. /evidence=ECO:0000250 1..304 72/185 (39%)
Sufficient for interaction with DAPK3. /evidence=ECO:0000250 1..125
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..72
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 90..139 4/11 (36%)
Sufficient for interaction with DAPK3. /evidence=ECO:0000250 124..416 113/316 (36%)
STKc_NLK 137..508 CDD:173748 129/387 (33%)
TQE 298..300 1/1 (100%)
Required for homodimerization and kinase activation and localization to the nucleus. /evidence=ECO:0000250 428..527 12/68 (18%)
Required for interaction with TAB2. /evidence=ECO:0000250 434..527 12/62 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.