DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and pink1

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001008628.1 Gene:pink1 / 494085 ZFINID:ZDB-GENE-041212-53 Length:574 Species:Danio rerio


Alignment Length:287 Identity:72/287 - (25%)
Similarity:112/287 - (39%) Gaps:86/287 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 KLVNHKNIIGLLNAFTPQRNL-----EEFQDV----------------YLVMELMDANLCQVIQM 119
            :|..|.|:|.:..|||.:..|     ||:.||                :|||:.....|.|.:::
Zfish   255 RLSAHPNVITVYRAFTAEVPLLPGAREEYPDVLPTRLNPHGLGSNRTLFLVMKNYPCTLRQYLEV 319

  Fly   120 DLDHDRMSYLLY-QMLCGIKHLHSAGIIHRDLKPSNIVVKADCT----LKILDFG--LARTAGTT 177
            .:.....:.|:: |:|.|:.||....|.|||||..||:::.|.|    |.|.|||  ||..:|..
Zfish   320 CVPKRTQASLMFLQLLEGVDHLCRQNIAHRDLKSDNILLEFDNTGCPRLVITDFGCCLAEDSGLK 384

  Fly   178 FMMTPYVVTR----YYRAPEV---ILGMGYT---ENVDIWSVGCIMGEMIRGGVLFPGTDHIDQW 232
            ...:.:.|.|    ...||||   :.|.|..   ...|:|:||.|..|:                
Zfish   385 LPFSSWWVNRGGNSCLMAPEVSTAVPGPGVVIDYSKADVWAVGAIAYEL---------------- 433

  Fly   233 NKIIEQLGTPSPSFMQRLQPTVRNYVENR-PRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNL 296
                  .|.|:|.:...    .|:|.|.: |     :.....||                |.:.:
Zfish   434 ------FGQPNPFYTLE----SRSYQEKQLP-----ALPAAAPD----------------DVQLV 467

  Fly   297 LSKMLVIDPEQRISVDEALKHEYINVW 323
            :..:|..:|.:|.|...|....:|::|
Zfish   468 VKLLLRKNPHKRPSARVAANILHISLW 494

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 72/287 (25%)
pink1NP_001008628.1 STKc_PINK1 149..494 CDD:270920 71/285 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.