DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and Doa

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001014681.2 Gene:Doa / 43415 FlyBaseID:FBgn0265998 Length:2045 Species:Drosophila melanogaster


Alignment Length:409 Identity:103/409 - (25%)
Similarity:167/409 - (40%) Gaps:108/409 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREF 72
            |.....||   .:|.||..:..:|.|..|.|....|......:|:|.:    :||    ..|||.
  Fly  1679 HLIYHTGD---ILHHRYKIMATLGEGTFGRVVKVKDMERDYCMALKII----KNV----EKYREA 1732

  Fly    73 KLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMD-----ANLCQVIQM------------- 119
            ..::          :||.......:...| :|.::::|     .::|.|.:|             
  Fly  1733 AKLE----------INALEKIAQKDPHCD-HLCVKMIDWFDYHGHMCIVFEMLGLSVFDFLRENN 1786

  Fly   120 --DLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIV-VKADCT------------------L 163
              ....|::.::.||:...:|.||...:.|.||||.||: |.:|.|                  :
  Fly  1787 YEPYPLDQVRHMAYQLCYSVKFLHDNRLTHTDLKPENILFVDSDYTSHYNHKINREVRRVKNTDV 1851

  Fly   164 KILDFGLARTAGTTF---MMTPYVVTRYYRAPEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPG 225
            :::|||.|     ||   ..:..|.||:||||||||.:|:::..|:||:|||:.|:..|..||..
  Fly  1852 RLIDFGSA-----TFDHEHHSTIVSTRHYRAPEVILELGWSQPCDVWSIGCILFELYLGITLFQT 1911

  Fly   226 TD---HIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSR 287
            .|   |:....:|:.|:    |..|.|....   |.:.:.:|        |..|....|...::.
  Fly  1912 HDNREHLAMMERILGQI----PYRMARNHTL---YSKTKTKY--------FYHGKLDWDEKSSAG 1961

  Fly   288 R------------KASDAR------NLLSKMLVIDPEQRISVDEALKHEYIN---VWYDAEEVDA 331
            |            :.||:.      :|:.|||..:|..||::.|||.|.:.:   ..:...||..
  Fly  1962 RYVRDHCKPLFLCQLSDSEDHCELFSLIKKMLEYEPSSRITLGEALHHPFFDRLPPHHRVGEVSN 2026

  Fly   332 PAPEPYDHSVDEREHTVEQ 350
            ..|.....|..||.|::.:
  Fly  2027 KQPLSSGSSSRERSHSLSR 2045

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 99/394 (25%)
DoaNP_001014681.2 PKc_CLK 1679..2012 CDD:271036 96/374 (26%)
S_TKc 1692..2012 CDD:214567 91/358 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.