DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and pak5

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_998127.1 Gene:pak5 / 405898 ZFINID:ZDB-GENE-040426-2085 Length:711 Species:Danio rerio


Alignment Length:326 Identity:81/326 - (24%)
Similarity:147/326 - (45%) Gaps:61/326 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 HQHY------TVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTH 64
            |:.:      .||.||....:.|    ...||.|:.||||.|.:..:.:.||:||:.  .:....
Zfish   421 HEQFRAALQLVVEPGDPRQGLDS----FLKIGEGSTGIVCIATEKHSGKQVAVKKMD--LRKQQR 479

  Fly    65 AKRAYREFKLMKLVNHKNIIGLLNAFTPQRNLEEFQDVYLVMELMDANLCQ--VIQMDLDHDRMS 127
            .:..:.|..:|:..:|:|::.:.|::...      .::::|||.::.....  |....::.::::
Zfish   480 RELLFNEVVIMRDYHHENVVDMYNSYLVG------DELWVVMEFLEGGALTDIVTHTRMNEEQIA 538

  Fly   128 YLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGL-ARTAGTTFMMTPYVVTRYYRA 191
            .:...:|..:.:||:.|:||||:|..:|::.:|..:|:.|||. |:.:.........|.|.|:.|
Zfish   539 TVCLSVLKALSYLHTQGVIHRDIKSDSILLTSDGRIKLSDFGFCAQVSKEVPKRKSLVGTPYWMA 603

  Fly   192 PEVILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRN 256
            ||||..:.|...|||||:|.::.||:.|                      ..|.|.:.....:|.
Zfish   604 PEVISRLPYGTEVDIWSLGIMVIEMVDG----------------------EPPYFNEPPLQAMRR 646

  Fly   257 YVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYIN 321
            ..:|.|       .||           :.|.:.:|..|..|..|||.:|.||.|..|.|::.::.
Zfish   647 IRDNLP-------PRL-----------KESHKVSSVLRAFLDLMLVREPSQRASALELLQNPFLK 693

  Fly   322 V 322
            :
Zfish   694 L 694

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 75/303 (25%)
pak5NP_998127.1 CRIB_PAK_like 9..55 CDD:238526
STKc_PAK5 418..709 CDD:132989 81/326 (25%)
S_TKc 446..692 CDD:214567 75/293 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.