DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and Srpk79D

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001246881.1 Gene:Srpk79D / 40461 FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster


Alignment Length:226 Identity:56/226 - (24%)
Similarity:82/226 - (36%) Gaps:72/226 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 IHRDLKPS---------------NIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVI 195
            :|.:..||               :::..::..:||.|.|.|......|  |..:.||.||:.||:
  Fly   820 VHANAIPSQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHF--TEDIQTRQYRSIEVL 882

  Fly   196 LGMGYTENVDIWSVGCIMGEMIRGGVLFP---------GTDHIDQWNKIIEQLGTPSPSFMQR-- 249
            ||..|....||||..|:..|:..|..||.         ..||:..   |:|.||:...|.:.|  
  Fly   883 LGAPYNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAH---IVELLGSIPQSVIFRGK 944

  Fly   250 -------LQPTVRNYVENRP------RYTGYSFD----RLFPDGLFPNDNNQNSRRKASDARNLL 297
                   ...::||..:.:|      ....|.:|    :.|.|.|.|                  
  Fly   945 HGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLP------------------ 991

  Fly   298 SKMLVIDPEQRISVDEALKHEYINVWYDAEE 328
              ||..:|..|.|..|.|:|.    |.:.||
  Fly   992 --MLEYNPVIRASAAECLQHP----WLEQEE 1016

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 56/226 (25%)
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038
S_TKc 347..>492 CDD:214567
STKc_SRPK <844..1012 CDD:271038 50/196 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.