DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and LOC365949

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_017446840.1 Gene:LOC365949 / 365949 RGDID:1590827 Length:194 Species:Rattus norvegicus


Alignment Length:103 Identity:28/103 - (27%)
Similarity:49/103 - (47%) Gaps:25/103 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 SRRKASDARNLLSKMLVIDPEQRISVDEALKHEYIN---VWY-------------------DAEE 328
            |.:...:|.:||.:|||.||.:|||..:||.|.|::   :.|                   |.|.
  Rat    29 SSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEP 93

  Fly   329 VDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDYEAHN 366
            |..|   .:|.:.::...:|.|.||:|::.:::.:..|
  Rat    94 VTNP---KFDDTFEKNLSSVRQVKEIIHQFILEQQKGN 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 27/94 (29%)
LOC365949XP_017446840.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.