DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and p38b

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_477361.1 Gene:p38b / 34780 FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster


Alignment Length:370 Identity:168/370 - (45%)
Similarity:237/370 - (64%) Gaps:25/370 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTTAQHQHYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHA 65
            |:....:.|.:::..|.:.|...|.||:|:|.||.|.||.|....|...||||||:||||:..||
  Fly     1 MSRKMAKFYKLDINRTEWEIPETYQNLQPVGQGAYGQVCKAVVRGTSTKVAIKKLARPFQSAVHA 65

  Fly    66 KRAYREFKLMKLVNHKNIIGLLNAFTPQR---NLEEFQDVYLVMELMDANLCQVIQ-MDLDHDRM 126
            ||.|||.:|:|.::|:|:||||:.|.|.:   :|::||.||:|..||||:|..:|: ..|..|.:
  Fly    66 KRTYRELRLLKHMDHENVIGLLDVFHPGQPADSLDQFQQVYMVTHLMDADLNNIIRTQKLSDDHV 130

  Fly   127 SYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRA 191
            .:|:||:|.|:|::||||:||||||||||.|..||.|:||||||||.|.:.  ||.||.||:|||
  Fly   131 QFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPAESE--MTGYVATRWYRA 193

  Fly   192 PEVILG-MGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRL-QPTV 254
            ||::|. |.|.:..|||||||||.|::.|..||||||||.|.|.|:|.||||:..||.|: ..:.
  Fly   194 PEIMLNWMHYNQTADIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEVLGTPADEFMSRISSESA 258

  Fly   255 RNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASD-ARNLLSKMLVIDPEQRISVDEALKHE 318
            |||:.:.|              :.|..|.::..|.|:. |.:||.|||.:|.::||:.::||.|.
  Fly   259 RNYIRSLP--------------VMPRRNFRDIFRGANPLAIDLLEKMLELDADKRITAEQALAHP 309

  Fly   319 YINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDYE 363
            |:..::|  ..|......||.|.:|.|..||:|:|:::.||..::
  Fly   310 YMEKYHD--PTDEQTAALYDQSFEENELPVEKWREMVFSEVTAFK 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 162/342 (47%)
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 167/363 (46%)
S_TKc 24..311 CDD:214567 150/302 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442183
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D34458at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24055
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.