DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and Pink1

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001100164.1 Gene:Pink1 / 298575 RGDID:1305769 Length:257 Species:Rattus norvegicus


Alignment Length:56 Identity:15/56 - (26%)
Similarity:23/56 - (41%) Gaps:9/56 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 ILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRL 250
            :||.|    .|:.|.|. .||...|...||....: .||   ...|:.|.:.:.::
  Rat   190 LLGKG----PDVVSKGA-DGEQAPGAPAFPFAIKM-MWN---ISAGSSSEAILSKM 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 15/56 (27%)
Pink1NP_001100164.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..60
Required for outer membrane localization. /evidence=ECO:0000250|UniProtKB:Q9BXM7 111..117
PKc_like 162..>240 CDD:304357 15/56 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.