powered by:
Protein Alignment bsk and Pink1
DIOPT Version :9
Sequence 1: | NP_001162930.1 |
Gene: | bsk / 44801 |
FlyBaseID: | FBgn0000229 |
Length: | 372 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001100164.1 |
Gene: | Pink1 / 298575 |
RGDID: | 1305769 |
Length: | 257 |
Species: | Rattus norvegicus |
Alignment Length: | 56 |
Identity: | 15/56 - (26%) |
Similarity: | 23/56 - (41%) |
Gaps: | 9/56 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 195 ILGMGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRL 250
:||.| .|:.|.|. .||...|...||....: .|| ...|:.|.:.:.::
Rat 190 LLGKG----PDVVSKGA-DGEQAPGAPAFPFAIKM-MWN---ISAGSSSEAILSKM 236
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.