DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and Mapk3

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_036082.1 Gene:Mapk3 / 26417 MGIID:1346859 Length:380 Species:Mus musculus


Alignment Length:357 Identity:144/357 - (40%)
Similarity:221/357 - (61%) Gaps:31/357 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKN 82
            |.:..||..|:.||.||.|:|.:|||.:.:..|||||:| ||::.|:.:|..||.:::....|:|
Mouse    37 FDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKIS-PFEHQTYCQRTLREIQILLRFRHEN 100

  Fly    83 IIG---LLNAFTPQRNLEEFQDVYLVMELMDANLCQVIQ-MDLDHDRMSYLLYQMLCGIKHLHSA 143
            :||   :|.|.|    ||..:|||:|.:||:.:|.:::: ..|.:|.:.|.|||:|.|:|::|||
Mouse   101 VIGIRDILRAPT----LEAMRDVYIVQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSA 161

  Fly   144 GIIHRDLKPSNIVVKADCTLKILDFGLARTAGT----TFMMTPYVVTRYYRAPEVIL-GMGYTEN 203
            .::||||||||:::...|.|||.||||||.|..    |..:|.||.||:|||||::| ..|||::
Mouse   162 NVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKS 226

  Fly   204 VDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQ-RLQPTVRNYVENRPRYTGY 267
            :||||||||:.||:....:|||..::||.|.|:..||:||...:. .:....|||:::.|..|..
Mouse   227 IDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKV 291

  Fly   268 SFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYDAEEVDAP 332
            ::.:|||             :..|.|.:||.:||..:|.:||:|:|||.|.|:..:||  ..|.|
Mouse   292 AWAKLFP-------------KSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYD--PTDEP 341

  Fly   333 -APEPYDHSVDEREHTVEQWKELIYEEVMDYE 363
             |.||:...::..:...|:.||||::|...::
Mouse   342 VAEEPFTFDMELDDLPKERLKELIFQETARFQ 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 142/346 (41%)
Mapk3NP_036082.1 STKc_ERK1_2_like 37..371 CDD:270839 144/353 (41%)
TXY 203..205 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.