DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and AgaP_AGAP012148

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_320380.4 Gene:AgaP_AGAP012148 / 1280530 VectorBaseID:AGAP012148 Length:184 Species:Anopheles gambiae


Alignment Length:193 Identity:80/193 - (41%)
Similarity:119/193 - (61%) Gaps:23/193 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 MTPYVVTRYYRAPEVILG-MGYTENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPS 243
            ||.||.||:|||||::|. |.|.:.||||||||||.|::.|..||||||||.|.|.|:|.||||:
Mosquito     1 MTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEILGTPN 65

  Fly   244 PSFMQRL-QPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASD-ARNLLSKMLVIDPE 306
            ..||.:: ..:.|:|:::.|:....:|..:|              |.|:. |.:||.|||.:|.:
Mosquito    66 DEFMAKISSESARHYIKSLPKTEKRNFSDVF--------------RGANPLAIDLLEKMLELDAD 116

  Fly   307 QRISVDEALKHEYINVWYDAEEVDAPAPEPYDHSVDEREHTVEQWKELIYEEVMDY----EAH 365
            :||:.::||.|.|:..:  |:..|.|....||.|.::.:..||:||||:::||:::    .||
Mosquito   117 KRITAEQALAHPYLEKY--ADPSDEPTSSLYDQSFEDMDLPVERWKELVFKEVLNFVPQQHAH 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 76/181 (42%)
AgaP_AGAP012148XP_320380.4 PKc_like <1..172 CDD:304357 78/186 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D34458at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.