DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and AgaP_AGAP005772

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_315787.4 Gene:AgaP_AGAP005772 / 1276441 VectorBaseID:AGAP005772 Length:289 Species:Anopheles gambiae


Alignment Length:305 Identity:105/305 - (34%)
Similarity:153/305 - (50%) Gaps:30/305 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGLL 87
            :|..|..||.|..|.|....:..|.:.||:|::.....:......|.||..|:|.:.||||:.|.
Mosquito     3 KYEKLEKIGEGTYGTVFKGKNRDTLEIVALKRVRLDEDDEGVPSSALREICLLKELKHKNIVRLY 67

  Fly    88 NAFTPQRNLEEFQDVYLVMELMDANLCQV---IQMDLDHDRMSYLLYQMLCGIKHLHSAGIIHRD 149
            :.....:.|.      ||.|..|.:|.:.   :..::|.|.:...:||:|.|:...||..::|||
Mosquito    68 DVLHSDKKLT------LVFEHCDQDLKKYFDSLNGEIDPDVVKSFMYQLLRGLAFCHSHNVLHRD 126

  Fly   150 LKPSNIVVKADCTLKILDFGLARTAGTTF-MMTPYVVTRYYRAPEVILGMG-YTENVDIWSVGCI 212
            |||.|:::..:..||:.||||||..|... ..:..|||.:||.|:|:.|.. ||.::|:||.|||
Mosquito   127 LKPQNLLINKNGELKLADFGLARAFGIPVKCYSAEVVTLWYRPPDVLFGAKLYTTSIDMWSAGCI 191

  Fly   213 MGEMIRGG-VLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGYSFDRLFPDG 276
            ..|:...| .||||:|..||..:|.:.||||..              ||.|..|..|..:.||  
Mosquito   192 FAELANAGRPLFPGSDVDDQLKRIFKLLGTPEE--------------ENWPGITQLSDYKPFP-- 240

  Fly   277 LFPNDN--NQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEY 319
            |:|...  :|...|..|..|:||.|:||..|..|:|.::|:.|.|
Mosquito   241 LYPPTTSWSQVVPRLNSKGRDLLQKLLVCRPLLRLSAEQAMSHPY 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 105/305 (34%)
AgaP_AGAP005772XP_315787.4 STKc_CDK5 3..286 CDD:143344 105/305 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.