DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and LOC116412424

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_031762492.1 Gene:LOC116412424 / 116412424 -ID:- Length:454 Species:Xenopus tropicalis


Alignment Length:145 Identity:34/145 - (23%)
Similarity:51/145 - (35%) Gaps:53/145 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 IMGEMIRGGVL--FPGTD------HIDQWN----KIIEQLGT--------------------PSP 244
            :||.::....|  ||.|.      :|:.||    |:...|.|                    .|.
 Frog   300 LMGAVVVAFFLCNFPDTASSLMQIYIENWNAHVYKVYTWLKTYLSLPLWYLNSALDPILFCISST 364

  Fly   245 SFMQRLQPTVRNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQR- 308
            ||......|:..::   |.|      ....||  |.:.||     ||..|:.:|. ||..|..| 
 Frog   365 SFRSACWETLTTFI---PWY------EKSLDG--PGNTNQ-----ASCVRSGVSS-LVSAPSTRS 412

  Fly   309 ---ISVDEALKHEYI 320
               ::.:|..:.||:
 Frog   413 TWTLNSNEGEQKEYL 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 34/145 (23%)
LOC116412424XP_031762492.1 7tm_GPCRs 54..369 CDD:421689 15/68 (22%)
TM helix 1 54..81 CDD:410628
TM helix 2 89..115 CDD:410628
TM helix 3 128..158 CDD:410628
TM helix 4 170..192 CDD:410628
TM helix 5 230..269 CDD:410628
TM helix 6 292..322 CDD:410628 6/21 (29%)
TM helix 7 337..363 CDD:410628 2/25 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.