DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and mapk4

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_004910415.1 Gene:mapk4 / 100498202 XenbaseID:XB-GENE-484178 Length:577 Species:Xenopus tropicalis


Alignment Length:355 Identity:102/355 - (28%)
Similarity:180/355 - (50%) Gaps:60/355 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKN 82
            :.:...:::.:|:|.||.|:|.:|.|:...:.||:||::  ..:....|.|.||.|:::.:||.|
 Frog    14 YDLGCHFVDFKPLGFGANGLVLSAVDSKNSRRVAVKKIA--ISDGRSMKHALREIKIIRRLNHDN 76

  Fly    83 IIGLLNAFTP-----QRNLEEFQDVYLVMELMDANLCQVI-QMDLDHDRMSYLLYQMLCGIKHLH 141
            |:.:.....|     |.::.::..||:|.|.|:.:|.|:: |..|..|.....:||:|.|:|::|
 Frog    77 IVKVHAVLGPRGADLQGDILKYNLVYIVQEHMETDLAQLLEQGPLTEDHAKLFMYQLLRGLKYIH 141

  Fly   142 SAGIIHRDLKPSNIVVKA-DCTLKILDFGLARTAGTTFMMTPY----VVTRYYRAPEVILG-MGY 200
            |..::||||||:||.:.. :..|||.||||||.....:....|    :||::||:|.::|. ..|
 Frog   142 STNVLHRDLKPANIFISTEELLLKIGDFGLARIVDQHYSHKGYLSEGLVTKWYRSPRLLLSPNNY 206

  Fly   201 TENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKII-----------EQLGTPSPSFMQRLQPTV 254
            |:.:|:|:.|||:.||:.|.:||.|:..::|...|:           |:|....|||:.      
 Frog   207 TKAIDMWAAGCILAEMLTGRMLFAGSHELEQMQLILDTIPVIHEEDKEELLKVMPSFIN------ 265

  Fly   255 RNYVENRPRYTGYSFDRLFPDGLFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEY 319
            .::...:|      ..:|.|:             ..|:|.:.|.|:|..:|..|::.:.||:|.|
 Frog   266 ASWEVRKP------LRKLLPE-------------MNSEAIDFLEKILTFNPMDRLTAEAALQHPY 311

  Fly   320 INVWYDAEEVDAPAPEPYDHSVDEREHTVE 349
            :          :|...|.|..:.:....:|
 Frog   312 M----------SPYSCPEDEPISQHPFRIE 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 102/350 (29%)
mapk4XP_004910415.1 STKc_MAPK4_6 14..351 CDD:143359 102/355 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D741207at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.