DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and cilk1

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_002934912.3 Gene:cilk1 / 100498050 XenbaseID:XB-GENE-985841 Length:623 Species:Xenopus tropicalis


Alignment Length:338 Identity:104/338 - (30%)
Similarity:160/338 - (47%) Gaps:46/338 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SRYINLRPIGSGAQGIVCAAYDTITQQNVAIKKLSRPFQNVTHAKRAYREFKLMKLVNHKNIIGL 86
            :||..::.:|.|..|.|.......:.:.|||||:.|.|.:...... .||.|.:|.:||.|:|.|
 Frog     2 NRYTTVKQLGDGTYGSVILGRSVESGELVAIKKMKRKFYSWDECMN-LREVKSLKKLNHANVIKL 65

  Fly    87 LNAFTPQRNLEEFQDVYLVMELMDANLCQVIQMDLDHDRM------SYLLYQMLCGIKHLHSAGI 145
                  :..:.|...:|.|.|.|..||.|:::   |.:::      ..::||:|.|:.::|..|.
 Frog    66 ------KEVIRENNQLYFVFEYMKENLYQLMK---DRNKLFPESIIRNIMYQILQGLAYIHKYGF 121

  Fly   146 IHRDLKPSNIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVIL-GMGYTENVDIWSV 209
            .||||||.|::......:||.||||||...:....|.||.||:||||||:| ...|...:|||:|
 Frog   122 FHRDLKPENLLCMGPELVKIADFGLARETRSRPPYTDYVSTRWYRAPEVLLRATNYNSPIDIWAV 186

  Fly   210 GCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVENRPRYTGYSF--DRL 272
            ||||.|:.....||||:..:|...||.:.||||..:          ::.|.....:..:|  ...
 Frog   187 GCIMAEIYTLRPLFPGSSEVDTIFKICQVLGTPKKN----------DWFEGFQLASAMNFRWAHC 241

  Fly   273 FPDG---LFPNDNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHEYINVWYD------AEE 328
            .|..   |.||        ..:|...::..||..||::|.:..:||::.|..|...      ..|
 Frog   242 VPSNLKTLIPN--------ACADGIQVMRDMLQWDPKKRPTASQALRYSYFQVGQTLGTSPRIHE 298

  Fly   329 VDAPAPEPYDHSV 341
            :.....||::..:
 Frog   299 LSKQQKEPHEKQI 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 104/337 (31%)
cilk1XP_002934912.3 STKc_MAK_like 4..284 CDD:270824 98/307 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.