DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and LOC100145764

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:XP_017950457.1 Gene:LOC100145764 / 100145764 -ID:- Length:419 Species:Xenopus tropicalis


Alignment Length:133 Identity:27/133 - (20%)
Similarity:48/133 - (36%) Gaps:41/133 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 APEVILGMG---------YTENVDIWSVGCIMGEMIRGGVLFPGTDHI----DQWNKIIEQLG-- 240
            :|:..:|.|         :..|.|:::| ...|.:.:|..  |..::|    :|..||.:::.  
 Frog    80 SPDRQVGKGEWNRYKFLLFHPNGDLYAV-TKSGHLYKGPA--PNNENISWGYEQATKIGDRIWND 141

  Fly   241 ---------------TPSPSFMQRLQPTV-------RNYVENRPRYTGYS-FDRLFPDGLFPNDN 282
                           |||....:|..||.       .:.:..:..:..|: |.|..|||......
 Frog   142 FSAYFFDPEGMLYVVTPSGDLRKRSPPTSASDDWLGTSSIVGQGSWKDYTHFIRFTPDGYLWCVE 206

  Fly   283 NQN 285
            |.|
 Frog   207 NSN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 27/133 (20%)
LOC100145764XP_017950457.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.