DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bsk and XB5772073

DIOPT Version :9

Sequence 1:NP_001162930.1 Gene:bsk / 44801 FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster
Sequence 2:NP_001120004.1 Gene:XB5772073 / 100144966 XenbaseID:XB-GENE-5772074 Length:398 Species:Xenopus tropicalis


Alignment Length:392 Identity:100/392 - (25%)
Similarity:156/392 - (39%) Gaps:107/392 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HYTVEVGDTNFTIHSRYINLRPIGSGAQGIVCAAYDTITQQNVAIK--KLSRPFQNVTHAKRAYR 70
            ::.|:.||   .::.||..:..:|.|....|...:|...::.||:|  |..|.|     ::.|..
 Frog    33 YHPVQAGD---MLNRRYQAIHKVGWGYFSTVWLCHDLQKKKKVAVKISKSGRRF-----SEAALD 89

  Fly    71 EFKLMKLVN--------HKNIIGLLNAFTPQRNL--EEFQDVYLVMELMDANLCQVIQMDLDHDR 125
            |..::..||        .:|:|.||:.|    .|  |....|.||.||:..:|..:::   :|..
 Frog    90 EISILNCVNGARKKESQGENVIQLLDDF----KLIGENGLHVCLVFELLGPSLLHLMR---NHGS 147

  Fly   126 -------MSYLLYQMLCGIKHLHS-AGIIHRDLKPSNIV--VKAD----CT-------------- 162
                   :..:|.|:|.|:..||. ..|||.|:||.||:  ||||    |.              
 Frog   148 EGLPLTCVRRVLQQVLQGLNFLHKRCRIIHTDIKPENILVCVKADNLQQCMAEATIWSQNKAGDR 212

  Fly   163 -----------------------LKILDFGLARTAGTTFMMTPYVVTRYYRAPEVILGMGYTENV 204
                                   :||.|.|  .:..|....:..:.|:.|||.||:||..|:..|
 Frog   213 TEQGVDVNFLTHLFESGNSDMLGVKIADLG--SSCWTYKAFSEEIQTQQYRALEVLLGSTYSTPV 275

  Fly   205 DIWSVGCIMGEMIRGGVLFP---------GTDHIDQWNKIIEQLGTPSPSFMQRLQPTVRNYVEN 260
            ||||..|:..||.....||.         ..|||   ..|:|.||        |:.|.|.:....
 Frog   276 DIWSTACMAFEMATSYYLFEPHAGKTFTREDDHI---ACIMELLG--------RIPPKVISSGRK 329

  Fly   261 RPRYTGYSFD-----RLFPDGLFPN--DNNQNSRRKASDARNLLSKMLVIDPEQRISVDEALKHE 318
            .|.:.....|     :|:|.||:..  ..::..:.:|....:.|..||....|:|.:.:..|:|.
 Frog   330 SPAFFNKQGDLLRIPQLYPCGLYDTLVRRHRWQKNEALTFASFLLPMLEYVSEKRATAETCLQHP 394

  Fly   319 YI 320
            ::
 Frog   395 WL 396

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 97/377 (26%)
XB5772073NP_001120004.1 STKc_SRPK 35..396 CDD:271038 100/388 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.