DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment eEF1gamma and EEF1E1

DIOPT Version :9

Sequence 1:	NP_001189308.1	Gene:	eEF1gamma / 44791	FlyBaseID:	FBgn0029176	Length:	431	Species:	Drosophila melanogaster
Sequence 2:	NP_004271.1	Gene:	EEF1E1 / 9521	HGNCID:	3212	Length:	174	Species:	Homo sapiens

Alignment Length:	142	Identity:	37/142 - (26%)
Similarity:	66/142 - (46%)	Gaps:	26/142 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    54 KVPAFETAEGQYLSESNAIAYLL---ANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPL 115
            ::|..:|..|..|:....||..|   ||::...|.....:|.||||:.:.
Human    29 QIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYR--------------- 78

  Fly   116 LGILPQQKNSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSV--RS 178
               :.|....::|.:...:|:.||..|:|..:|.|...|||||:::..   |:.::::.:|  :.
Human    79 ---VTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYG---LHRFIVDLTVQEKE 137

  Fly   179 AFGNVNRWFVTI 190
            .:.||:|||..|
Human   138 KYLNVSRWFCHI 149

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
eEF1gamma	NP_001189308.1	GST_N_EF1Bgamma	4..79	CDD:239342	8/27 (30%)
		GstA	5..187	CDD:223698	34/137 (25%)
		GST_C_EF1Bgamma_like	90..209	CDD:198290	27/103 (26%)
		EF1G	271..376	CDD:279041
EEF1E1	NP_004271.1	N-terminal	2..56		7/26 (27%)
		Linker	57..63		0/5 (0%)
		C-terminal	64..152		27/107 (25%)
		GST_C_AIMP3	65..165	CDD:198338	27/106 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0625
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810