DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and yibF

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_418049.1 Gene:yibF / 948113 ECOCYCID:EG11762 Length:202 Species:Escherichia coli


Alignment Length:181 Identity:41/181 - (22%)
Similarity:68/181 - (37%) Gaps:42/181 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YTYPENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEG-------- 63
            ||.|   ...|..|.....|...:..:...:...|..|:|   .|.||||...|.||        
E. coli     7 YTSP---FVRKLSILLLEKGITFEFINELPYNADNGVAQF---NPLGKVPVLVTEEGECWFDSPI 65

  Fly    64 --QYLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNST 126
              :|:...|....:|..:       |....:|::..:.||. |:.|.       |..:.:|....
E. coli    66 IAEYIELMNVAPAMLPRD-------PLESLRVRKIEALADG-IMDAG-------LVSVREQARPA 115

  Fly   127 AKQEAEAVLQQ---LNQKLQ-------DATFLAGERITLADIVVFSSLLHL 167
            |:|..:.:|:|   :|:.|.       |.| |..:.:.||.|.:..::.:|
E. coli   116 AQQSEDELLRQREKINRSLDVLEGYLVDGT-LKTDTVNLATIAIACAVGYL 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 20/81 (25%)
GstA 5..187 CDD:223698 41/181 (23%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 20/88 (23%)
EF1G 271..376 CDD:279041
yibFNP_418049.1 PRK10357 1..202 CDD:182405 41/181 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.