DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and yfcG

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_416805.1 Gene:yfcG / 946763 ECOCYCID:G7194 Length:215 Species:Escherichia coli


Alignment Length:138 Identity:36/138 - (26%)
Similarity:55/138 - (39%) Gaps:39/138 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EFLKKFPGGKVPAF------ETAEGQYLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNE 103
            |||:..|..|:||.      :..|...|.||.||...||.             :...::|....|
E. coli    42 EFLRISPNNKIPAIVDHSPADGGEPLSLFESGAILLYLAE-------------KTGLFLSHETRE 93

  Fly   104 IVPASCAWVF-------PLLGILPQQKNSTAKQ-----------EAEAVLQQLNQKLQDATFLAG 150
            .. |:..|:|       |:|| .....|..|.|           |.:.:...||::|:::.:|.|
E. coli    94 RA-ATLQWLFWQVGGLGPMLG-QNHHFNHAAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGG 156

  Fly   151 ERITLADI 158
            |..::|||
E. coli   157 ENYSIADI 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 15/39 (38%)
GstA 5..187 CDD:223698 36/138 (26%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 21/87 (24%)
EF1G 271..376 CDD:279041
yfcGNP_416805.1 PRK13972 1..215 CDD:172475 36/138 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.