DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and yncG

DIOPT Version :10

Sequence 1:NP_652000.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_415971.1 Gene:yncG / 946023 ECOCYCID:G6765 Length:205 Species:Escherichia coli


Alignment Length:137 Identity:31/137 - (22%)
Similarity:51/137 - (37%) Gaps:27/137 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FGETNKSAEFLKKF-PGGKVPAFETAEGQYLSESNAIAYLL-------------ANEQLRGGKCP 87
            |.....|.|.||.. |..:||.......:.::|:.|||.::             |..||......
E. coli    34 FDHEGASRELLKTLNPLCQVPTLALENDEIMTETAAIALMVLDRRPDLAPPVGRAERQLFQRLLV 98

  Fly    88 FVQAQVQQWISFAD--NEIVPASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKLQDATFLAG 150
            ::.|.|....:|||  ....|.:           |:|......:..:::...||.:|....:..|
E. coli    99 WLVANVYPTFTFADYPERWAPDA-----------PEQLKKNVIEYRKSLYIWLNSQLTAEPYAFG 152

  Fly   151 ERITLAD 157
            |::||.|
E. coli   153 EQLTLVD 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_652000.1 GST_N_EF1Bgamma 4..79 CDD:239342 13/55 (24%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 16/70 (23%)
EF1G 273..376 CDD:459888
yncGNP_415971.1 GstA 1..203 CDD:440390 31/137 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.