DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and sspA

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_417696.1 Gene:sspA / 944744 ECOCYCID:EG10977 Length:212 Species:Escherichia coli


Alignment Length:204 Identity:39/204 - (19%)
Similarity:71/204 - (34%) Gaps:45/204 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLYTYPENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAE------- 62
            ||::.|.:..:::..|.....|...::....|   .|...:.:...|...||.....|       
E. coli    12 TLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEK---DNPPQDLIDLNPNQSVPTLVDRELTLWESR 73

  Fly    63 --GQYLSESNAIAYLLANEQLRGGKCPFVQAQVQQ-WISFADNEIVPASCAWVFPLLGILPQQKN 124
              .:||.|......|:....:..|:......:::: |.:.. |.|:..|.:              
E. coli    74 IIMEYLDERFPHPPLMPVYPVARGESRLYMHRIEKDWYTLM-NTIINGSAS-------------- 123

  Fly   125 STAKQEAEAVLQQLNQKL--------QDATFLAGERITLADIVVFSSLLHLYEYVLE---PSVRS 178
                 ||:|..:||.::|        |...||:.| .:|.|..:...|..|.:..:|   |..:.
E. coli   124 -----EADAARKQLREELLAIAPVFGQKPYFLSDE-FSLVDCYLAPLLWRLPQLGIEFSGPGAKE 182

  Fly   179 AFGNVNRWF 187
            ..|.:.|.|
E. coli   183 LKGYMTRVF 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 15/82 (18%)
GstA 5..187 CDD:223698 38/202 (19%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 23/110 (21%)
EF1G 271..376 CDD:279041
sspANP_417696.1 sspA 1..211 CDD:236537 39/204 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.