Sequence 1: | NP_001189308.1 | Gene: | eEF1gamma / 44791 | FlyBaseID: | FBgn0029176 | Length: | 431 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014170.1 | Gene: | URE2 / 855492 | SGDID: | S000005173 | Length: | 354 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 253 | Identity: | 48/253 - (18%) |
---|---|---|---|
Similarity: | 100/253 - (39%) | Gaps: | 74/253 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 TLYTY---PENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYL 66
Fly 67 S--ESNAIAYLLANEQLRGGKCPFV-------QAQVQQWISFADNEIVPASCAWVFPLLG----- 117
Fly 118 -ILPQQKNSTA-------------------KQEAEAVLQQLNQKLQDA----------------- 145
Fly 146 TFLAGERITLADI--VVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVK 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
eEF1gamma | NP_001189308.1 | GST_N_EF1Bgamma | 4..79 | CDD:239342 | 21/78 (27%) |
GstA | 5..187 | CDD:223698 | 44/237 (19%) | ||
GST_C_EF1Bgamma_like | 90..209 | CDD:198290 | 25/156 (16%) | ||
EF1G | 271..376 | CDD:279041 | |||
URE2 | NP_014170.1 | GST_N_Ure2p_like | 114..194 | CDD:239346 | 22/81 (27%) |
GST_C_Ure2p | 208..350 | CDD:198326 | 25/157 (16%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0625 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |