DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and URE2

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_014170.1 Gene:URE2 / 855492 SGDID:S000005173 Length:354 Species:Saccharomyces cerevisiae


Alignment Length:253 Identity:48/253 - (18%)
Similarity:100/253 - (39%) Gaps:74/253 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLYTY---PENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYL 66
            ||:::   |..|:.  |::.::.......:..:|..|| :::.||:...|..:|||........|
Yeast   115 TLFSHRSAPNGFKV--AIVLSELGFHYNTIFLDFNLGE-HRAPEFVSVNPNARVPALIDHGMDNL 176

  Fly    67 S--ESNAIAYLLANEQLRGGKCPFV-------QAQVQQWISFADNEIVPASCAWVFPLLG----- 117
            |  ||.||...|.|:..:....|.:       |:|:..|:.|..:...        |::|     
Yeast   177 SIWESGAILLHLVNKYYKETGNPLLWSDDLADQSQINAWLFFQTSGHA--------PMIGQALHF 233

  Fly   118 -ILPQQKNSTA-------------------KQEAEAVLQQLNQKLQDA----------------- 145
             ....||.::|                   .:..||::.:|:.:...|                 
Yeast   234 RYFHSQKIASAVERYTDEVRRVYGVVEMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYP 298

  Fly   146 TFLAGERITLADI--VVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVK 201
            .:|.|:::|:||:  |.:::::..    :..:::..|..|.:|...::.:   .||:|
Yeast   299 VWLVGDKLTIADLAFVPWNNVVDR----IGINIKIEFPEVYKWTKHMMRR---PAVIK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 21/78 (27%)
GstA 5..187 CDD:223698 44/237 (19%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 25/156 (16%)
EF1G 271..376 CDD:279041
URE2NP_014170.1 GST_N_Ure2p_like 114..194 CDD:239346 22/81 (27%)
GST_C_Ure2p 208..350 CDD:198326 25/157 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.