DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GTT1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:38/226 - (16%)
Similarity:85/226 - (37%) Gaps:53/226 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAF-----ETAEGQYLSESN 70
            ::.||::.|....:...:.::....:........|..|..|.|:.|..     ||.:.:.|:||.
Yeast    12 DHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLEVQDRETGKKKILAESG 76

  Fly    71 AI----------AYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLL--GILPQQK 123
            .|          :::|.:|...      :..|:..::.:.:..:.|       ||:  .||.:.|
Yeast    77 FIFQYVLQHFDHSHVLMSEDAD------IADQINYYLFYVEGSLQP-------PLMIEFILSKVK 128

  Fly   124 NSTAKQEAEAVLQQLNQKLQDA----------TFLAGE-----------RITLADIVVFSSLLHL 167
            :|........:.:::..|:..|          .|:.||           :::.|||::...|...
Yeast   129 DSGMPFPISYLARKVADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLSGADILMSFPLQMA 193

  Fly   168 YEYVLEPSVRSAFGNVNRWFVTILNQKQVQA 198
            :|...  :....:..:::|..||.:::...|
Yeast   194 FERKF--AAPEDYPAISKWLKTITSEESYAA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 15/82 (18%)
GstA 5..187 CDD:223698 34/213 (16%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 22/132 (17%)
EF1G 271..376 CDD:279041
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 14/74 (19%)
GST_C_GTT1_like 93..218 CDD:198298 22/139 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.