DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GTT2

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:49/210 - (23%)
Similarity:90/210 - (42%) Gaps:28/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YPENFRAYKA----LIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSES 69
            ||...|...|    |.:.|:      |..|...|| :|..|||.|...|.||..|..:|..::|.
Yeast    29 YPARVRIALAEKNMLSSVQF------VRINLWKGE-HKKPEFLAKNYSGTVPVLELDDGTLIAEC 86

  Fly    70 NAIAYLLANEQLRG-----GKCPFVQAQVQQWISFADNEIV-PASCAWVFPLLGILP-----QQK 123
            .||...:  :.|.|     ||.|..:..:......|:.|:: |.|..:.....|:.|     |.|
Yeast    87 TAITEYI--DALDGTPTLTGKTPLEKGVIHMMNKRAELELLDPVSVYFHHATPGLGPEVELYQNK 149

  Fly   124 NSTAKQEAEAV--LQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRW 186
            ....:|..:|:  :...:..|::..::||:..::|||.|.:.|  ::..:::..|......:..|
Yeast   150 EWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGL--IFAAIVKLQVPEECEALRAW 212

  Fly   187 FVTILNQKQVQAVVK 201
            :..:..:..|:.:::
Yeast   213 YKRMQQRPSVKKLLE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 23/73 (32%)
GstA 5..187 CDD:223698 47/194 (24%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 21/120 (18%)
EF1G 271..376 CDD:279041
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 23/73 (32%)
GST_C_GTT2_like 106..222 CDD:198291 21/117 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.