DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GSTU23

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_177955.1 Gene:GSTU23 / 844167 AraportID:AT1G78320 Length:220 Species:Arabidopsis thaliana


Alignment Length:223 Identity:57/223 - (25%)
Similarity:88/223 - (39%) Gaps:47/223 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 AAQYSGAQVKVA-----DNFKFGE---TNKSAEFL------KKFP----GGKVPAFETAEGQYLS 67
            |:.| |.:.::|     ..:::.|   :|||...|      ||.|    .||.......:.||:.
plant    12 ASMY-GMRTRIALEEKKVKYEYREEDLSNKSPLLLQMNPIHKKIPVLIHEGKPICESIIQVQYID 75

  Fly    68 E----SNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNE-IVPASCAWVFPLLGILPQQKNSTA 127
            |    :|.|   |.::       |:.:||.:.|..:.|.: .||....|      ....:|...|
plant    76 ELWPDTNPI---LPSD-------PYQRAQARFWADYIDKKTYVPCKALW------SESGEKQEAA 124

  Fly   128 KQEAEAVLQQLNQKLQDATFLAGERITLADI--VVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTI 190
            |.|...||:.|:.:|.|..:..|....|.||  :.|.|....||.|...|:...|..:..|....
plant   125 KIEFIEVLKTLDSELGDKYYFGGNEFGLVDIAFIGFYSWFRTYEEVANLSIVLEFPKLMAWAQRC 189

  Fly   191 LNQKQVQAVVKDYKLCEKAL--VFDPKK 216
            |.::.|...:.|   .:|.|  |.|.:|
plant   190 LKRESVAKALPD---SDKVLKSVSDHRK 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 20/79 (25%)
GstA 5..187 CDD:223698 48/190 (25%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 31/121 (26%)
EF1G 271..376 CDD:279041
GSTU23NP_177955.1 GST_N_Tau 5..78 CDD:239356 17/66 (26%)
GST_C_Tau 89..211 CDD:198294 35/130 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.