DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GSTF6

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:216 Identity:56/216 - (25%)
Similarity:91/216 - (42%) Gaps:34/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYTYPENFRAYKALIAAQYSGAQVK-VADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQY-LSE 68
            ::.:|.:....:.|||........: |....|.|| :|...|:.:.|.|||||||  :|.: :.|
plant     6 VFGHPASTATRRVLIALHEKNVDFEFVHVELKDGE-HKKEPFILRNPFGKVPAFE--DGDFKIFE 67

  Fly    69 SNAIAYLLA-------NEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVF-----PLLGILPQ 121
            |.||...:|       |..|..||   ..|.:...|....:|..|.....|:     ||.|:   
plant    68 SRAITQYIAHEFSDKGNNLLSTGK---DMAIIAMGIEIESHEFDPVGSKLVWEQVLKPLYGM--- 126

  Fly   122 QKNSTAKQEAEA----VLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFG- 181
            ..:.|..:|.||    ||.....:|.::.:||.:..||.|:    ..:.:.:|:|....:..|. 
plant   127 TTDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVDL----HTIPVIQYLLGTPTKKLFDE 187

  Fly   182 --NVNRWFVTILNQKQVQAVV 200
              :|:.|...|.::...|.|:
plant   188 RPHVSAWVADITSRPSAQKVL 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 24/81 (30%)
GstA 5..187 CDD:223698 52/201 (26%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 28/123 (23%)
EF1G 271..376 CDD:279041
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 23/73 (32%)
GST_C_Phi 91..208 CDD:198296 28/126 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.