DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GSTF4

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:191 Identity:49/191 - (25%)
Similarity:84/191 - (43%) Gaps:35/191 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 YSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLA------NEQLR 82
            |....||:    :.|| :|:..||...|.|:||.||....: |.||.||...:|      ..||.
plant    62 YEPITVKL----QTGE-HKTEPFLSLNPFGQVPVFEDGSVK-LYESRAITQYIAYVHSSRGTQLL 120

  Fly    83 GGKCPFVQAQVQQWISFADNEIVP--ASCAW---VFPLLGILPQQKNSTAKQEAEAVLQQL---- 138
            ..:.....|.:..|:....::..|  :...|   :.|:.|:   :.:.|..:|.||:|:::    
plant   121 NLRSHETMATLTMWMEIEAHQFDPPASKLTWEQVIKPIYGL---ETDQTIVKENEAILEKVLNIY 182

  Fly   139 NQKLQDATFLAGERITLADIVVFSSLLHL--YEYVLEPSVRSAF---GNVNRWFVTILNQK 194
            .::|:::.|||....||.|      |.||  .:|:|....:..|   ..|.:|...|.:::
plant   183 EKRLEESRFLACNSFTLVD------LHHLPNIQYLLGTPTKKLFEKRSKVRKWVDEITSRE 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 20/60 (33%)
GstA 5..187 CDD:223698 47/182 (26%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 27/119 (23%)
EF1G 271..376 CDD:279041
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 19/52 (37%)
GST_C_Phi 126..243 CDD:198296 27/121 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.