DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and VARS1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_005249419.1 Gene:VARS1 / 7407 HGNCID:12651 Length:1265 Species:Homo sapiens


Alignment Length:482 Identity:127/482 - (26%)
Similarity:202/482 - (41%) Gaps:128/482 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TLYT--YPENFRAYKALIAAQY---------SGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAF 58
            |||.  :|:.|.:.:|||||:|         .||..::.  .:...|:::     .||..::||.
Human     3 TLYVSPHPDAFPSLRALIAARYGEAGEGPGWGGAHPRIC--LQPPPTSRT-----PFPPPRLPAL 60

  Fly    59 ETAE-GQYLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQ 122
            |... |.::..:.|:|.||....|.|.........||||:|:||.|::||:|....|.||:    
Human    61 EQGPGGLWVWGATAVAQLLWPAGLGGPGGSRAAVLVQQWVSYADTELIPAACGATLPALGL---- 121

  Fly   123 KNSTAKQEAEAVLQQLNQKLQDA-------TFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAF 180
              .::.|:.:|||..|.:.|...       |:||||..||||:...::||..:.|||:|..|..:
Human   122 --RSSAQDPQAVLGALGRALSPLEEWLRLHTYLAGEAPTLADLAAVTALLLPFRYVLDPPARRIW 184

  Fly   181 GNVNRWFVTILNQKQVQAVVKDYKLCEKA--LVFDPKKYAEFQAKTGAAKPQQQAQQQKQEKKPK 243
            .||.|||||.:.|.:.:||:.:..|...|  |...|...|....|| ||:.:::|:::::.:|.:
Human   185 NNVTRWFVTCVRQPEFRAVLGEVVLYSGARPLSHQPGPEAPALPKT-AAQLKKEAKKREKLEKFQ 248

  Fly   244 EKKEAPKKAAEPAEELDAADEALAAEPKSKDPFDALPKGTFNFD------DFKRVYSNEDEAKSI 302
            :|::..::...|.|:.....|    :.:.:||      |...:|      :.|.|.....::.|.
Human   249 QKQKIQQQQPPPGEQKKPKPE----KREKRDP------GVITYDLPTPPGEKKDVSGPMPDSYSP 303

  Fly   303 PYFFDKFDAENYSIWFGEYKYNEELSK----------VFMSC-----------------NLITGM 340
            .|    .:|..|..|..:..:..|..:          |||.|                 |.|...
Human   304 RY----VEAAWYPWWEQQGFFKPEYGRPNVSAANPRGVFMMCIPPPNVTGSLHLGHALTNAIQDS 364

  Fly   341 FQRLDKMRKAAFASVCLFGEDGNSTI-------SGI--------WVWRGQDL--------AFTLS 382
            ..|..:||             |.:|:       :||        .:||.|.|        ||.  
Human   365 LTRWHRMR-------------GETTLWNPGCDHAGIATQVVVEKKLWREQGLSRHQLGREAFL-- 414

  Fly   383 PDWQIDYEVYDWK--KLDAKSEETKKL 407
                  .||:.||  |.|....:.|||
Human   415 ------QEVWKWKEEKGDRIYHQLKKL 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 24/85 (28%)
GstA 5..187 CDD:223698 65/200 (33%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 47/125 (38%)
EF1G 271..376 CDD:279041 27/152 (18%)
VARS1XP_005249419.1 GstA <56..203 CDD:223698 54/152 (36%)
GST_C_ValRS_N 92..213 CDD:198327 47/126 (37%)
PTZ00419 283..1265 CDD:240411 36/178 (20%)
ValRS_core 336..939 CDD:185677 28/121 (23%)
tRNA-synt_1_2 514..>610 CDD:290334
Anticodon_Ia_Val 939..1076 CDD:153416
Val_tRNA-synt_C 1197..1259 CDD:287436
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.