DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and eef1e1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001373479.1 Gene:eef1e1 / 565440 ZFINID:ZDB-GENE-030131-4949 Length:173 Species:Danio rerio


Alignment Length:162 Identity:44/162 - (27%)
Similarity:73/162 - (45%) Gaps:35/162 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 ETNKSAEFL-----KKFP---GGKVPAFETAEGQYLSESNAIAYLLANEQLRG---GKCPFVQAQ 92
            |.|....||     .|:.   |.|||..:...|..|:....||..|..|..|.   |.....:|.
Zfish     5 ELNSLERFLGLKKANKYSTQGGKKVPVLQNNNGPALTGLVTIACHLVKEAKRPELLGDDAEQRAV 69

  Fly    93 VQQWISFADNEIVPASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKLQDATFLAGERITLAD 157
            ||||:.....::                   ::.:|:|.:.:|:.||:.|:|..:|||...||||
Zfish    70 VQQWLEHRITKL-------------------DNCSKEEVKVILKDLNRYLEDKVYLAGNVFTLAD 115

  Fly   158 IVVFSSLLHLYEYVLEPSV--RSAFGNVNRWF 187
            |:::..:.|:   ::|.::  :..:.||:|||
Zfish   116 ILMYYGIHHI---IVELAIQEKECYLNVSRWF 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 14/47 (30%)
GstA 5..187 CDD:223698 42/160 (26%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 27/100 (27%)
EF1G 271..376 CDD:279041
eef1e1NP_001373479.1 GST_C_AIMP3 64..161 CDD:198338 27/103 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.