DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and eprs1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_009291485.1 Gene:eprs1 / 562037 ZFINID:ZDB-GENE-030131-638 Length:1690 Species:Danio rerio


Alignment Length:236 Identity:47/236 - (19%)
Similarity:84/236 - (35%) Gaps:68/236 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTLYTYPENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSE 68
            |.|.| .|:.:....|...:.....:.|:|..:|.:.|....:|.:.    .||.    |.|   
Zfish    15 GALLT-AEHVKGSVNLSVEEGKDTMLHVSDQVQFSDVNSITRYLARV----APAL----GLY--- 67

  Fly    69 SNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNSTAKQEAEA 133
                           |.....|.:|..|:.|:...:    |                 .:.:..:
Zfish    68 ---------------GSNMMEQTEVDHWLEFSARRL----C-----------------GQSDLSS 96

  Fly   134 VLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQA 198
            .|..|::.|...|||.|..:||||:.::::|....|...:|   |:..::.|||..:.:|....:
Zfish    97 ALADLDKALALRTFLVGRSVTLADLCIWAALKGNGESQAKP---SSHPHLCRWFSFLSSQVPFSS 158

  Fly   199 VVKDYKLCEKALVFDPKKYAEFQAKTGAAKPQQQAQQQKQE 239
            |              ..|:|   :|..|:|.....:.:||:
Zfish   159 V--------------GSKWA---SKVSASKAASVEKDKKQD 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 14/74 (19%)
GstA 5..187 CDD:223698 35/181 (19%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 25/118 (21%)
EF1G 271..376 CDD:279041
eprs1XP_009291485.1 PLN02907 1..717 CDD:215492 47/236 (20%)
GST_C_GluProRS_N 73..153 CDD:198342 23/103 (22%)
tRNA-synt_1c 196..497 CDD:279135
tRNA-synt_1c_C 510..687 CDD:281883
Med25_SD1 716..901 CDD:288132
WEPRS_RNA 762..811 CDD:238473
WHEP-TRS 841..892 CDD:278865
WEPRS_RNA 911..960 CDD:238473
WEPRS_RNA 996..1045 CDD:238473
WHEP-TRS 1080..1132 CDD:278865
PRK08661 1197..1690 CDD:236327
ProRS_core_arch_euk 1201..1464 CDD:238401
ProRS_anticodon_zinc 1470..1690 CDD:238439
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.