DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and Gstt3

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_038954940.1 Gene:Gstt3 / 499422 RGDID:1562732 Length:298 Species:Rattus norvegicus


Alignment Length:176 Identity:48/176 - (27%)
Similarity:78/176 - (44%) Gaps:45/176 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PENFRAYKALIAAQYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQY-LSESNAIA 73
            |...|..:.|....|:.|         |.:.|         |..||||.:  :|.: |:||.||.
  Rat    84 PFQLRTIELLKGQHYTDA---------FAQVN---------PLRKVPALK--DGDFVLAESVAIL 128

  Fly    74 YLLANEQLRGGKCP--------FVQAQVQQWISFADNEIVPASCA----W---VFPL-LG-ILPQ 121
            ..|:    |..|.|        ..:|:|.:::::....:  .||.    |   :||: || .:|.
  Rat   129 LYLS----RKYKAPDHWYPQDLQTRARVDEYLAWQHTAL--RSCCSRAMWQKMMFPVFLGQPVPP 187

  Fly   122 QKNSTAKQEAEAVLQQLNQK-LQDATFLAGERITLADIVVFSSLLH 166
            ::.::...|.:..||.|..| ||:..||.|..|::||:|..:.|:|
  Rat   188 ERLASTLAELDGCLQMLEDKFLQNKAFLTGPHISVADLVAITELMH 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 19/69 (28%)
GstA 5..187 CDD:223698 48/176 (27%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 26/87 (30%)
EF1G 271..376 CDD:279041
Gstt3XP_038954940.1 GST_N_Theta 60..135 CDD:239348 20/74 (27%)
GST_C_Theta 149..273 CDD:198292 26/87 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.