DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and gstt1-like.2

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:XP_031748213.1 Gene:gstt1-like.2 / 496693 XenbaseID:XB-GENE-980731 Length:245 Species:Xenopus tropicalis


Alignment Length:213 Identity:50/213 - (23%)
Similarity:88/213 - (41%) Gaps:58/213 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KFGETNKSAEFLKKFPGGKVPAFETAEGQY-LSESNAIAYLLANEQLRGGKCP--------FVQA 91
            |.|| :.:.||.|.....||||.:  :|.: ::||.|:...||    |..|.|        ..:|
 Frog    40 KAGE-HLTQEFGKVSVLHKVPALK--DGNFTMAESTAMLLYLA----RKYKTPNHWYPSDLQKRA 97

  Fly    92 QVQQWISFADNEIVP--ASCAW---VFP-LLG-ILPQQKNSTAKQEAEAVLQQLNQK-LQDATFL 148
            :|.:::::......|  :...|   |.| :|| .:|.:|.:....|....:....:| |.:..|:
 Frog    98 RVDEYLAWQHTNTRPHGSKVFWTKCVSPTILGKEVPSEKMNAVMAEFVTTMNNFEEKFLGNKPFI 162

  Fly   149 AGERITLADIV-------VFSSLLHLYE----------YVLEPSVRSAFGNVNRWFVTILNQKQV 196
            ||:.|::||:|       |.:|.::::|          .::|......|...:.|.::...||  
 Frog   163 AGDEISVADLVAIVEIMQVIASGVNVFEERPKLGSWKQRLVEAVGEELFLEAHEWILSFSKQK-- 225

  Fly   197 QAVVKDYKLCEKALVFDP 214
                           |||
 Frog   226 ---------------FDP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 16/43 (37%)
GstA 5..187 CDD:223698 44/184 (24%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 28/143 (20%)
EF1G 271..376 CDD:279041
gstt1-like.2XP_031748213.1 GST_N_Theta 6..82 CDD:239348 17/48 (35%)
GST_C_Theta 95..221 CDD:198292 26/125 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.