DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GstD7

DIOPT Version :10

Sequence 1:NP_652000.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_525114.1 Gene:GstD7 / 48340 FlyBaseID:FBgn0010043 Length:224 Species:Drosophila melanogaster


Alignment Length:197 Identity:49/197 - (24%)
Similarity:80/197 - (40%) Gaps:32/197 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYTYPENFRAYKALIAAQYSGAQVKVADNFKFGETNK----SAEFLKKFPGGKVPAFETAEGQYL 66
            ||.:|....:....:.|:..|.::    |.|...|.:    ..||::..|...:|.. ...|..:
  Fly     6 LYNFPMAPASRAIQMVAKALGLEL----NSKLINTMEGDQLKPEFVRINPQHTIPTL-VDNGFVI 65

  Fly    67 SESNAIAYLLANEQLRGGK--------CPFVQAQVQQWISFADNEIVPASCAWVFPLL--GILPQ 121
            .||.|||..|..:.   ||        .|..:|.:.|.:.|....:..|...:.|.:.  |....
  Fly    66 WESRAIAVYLVE
KY---GKPDSPLYPNDPQKRALINQRLYFDMGTLYDALTKYFFLIFRTGKFGD 127

  Fly   122 QKNSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFS--SLLHLYEYVLEPSVRSAFGNVN 184
            |:   |..:..:....||..|:...|:||.::|:||||:.:  |.:..:.:.|     |.|.||.
  Fly   128 QE---ALDKVNSAFGFLNTFLEGQDFVAGSQLTVADIVILATVSTVEWFSFDL-----SKFPNVE 184

  Fly   185 RW 186
            ||
  Fly   185 RW 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_652000.1 GST_N_EF1Bgamma 4..79 CDD:239342 19/76 (25%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 27/101 (27%)
EF1G 273..376 CDD:459888
GstD7NP_525114.1 GST_N_Delta_Epsilon 4..77 CDD:239343 19/75 (25%)
GST_C_Delta_Epsilon 92..206 CDD:198287 27/103 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.