DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GstD6

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:140 Identity:37/140 - (26%)
Similarity:61/140 - (43%) Gaps:22/140 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 ESNAIAYLLANEQLRGG----KCPFVQAQVQQWISFADNEIVPASCAWVFPLL--GILPQQKNST 126
            |:.||...|..:..:..    |.|..||.:.|.:.|....:......:.||||  |....|:|  
  Fly    64 ETRAIVVYLVEQYGKDDSLYPKDPQKQALINQRLYFDMGTLYDGIAKYFFPLLRTGKPGTQEN-- 126

  Fly   127 AKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFS--SLLHLYEYVLEPSVRSAFGNVNRWFVT 189
             .::..|....||..|....::||.::::||||:.:  |...:.::.|:     .|.||:||:  
  Fly   127 -LEKLNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDLK-----KFPNVDRWY-- 183

  Fly   190 ILNQKQVQAV 199
                |..|.|
  Fly   184 ----KNAQKV 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 4/10 (40%)
GstA 5..187 CDD:223698 33/126 (26%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 31/114 (27%)
EF1G 271..376 CDD:279041
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 4/9 (44%)
PLN02395 11..208 CDD:166036 37/140 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/116 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459943
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.