Sequence 1: | NP_001189308.1 | Gene: | eEF1gamma / 44791 | FlyBaseID: | FBgn0029176 | Length: | 431 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001002621.1 | Gene: | gsto1 / 436894 | ZFINID: | ZDB-GENE-040718-365 | Length: | 240 | Species: | Danio rerio |
Alignment Length: | 208 | Identity: | 49/208 - (23%) |
---|---|---|---|
Similarity: | 73/208 - (35%) | Gaps: | 51/208 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 DNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGGKC----PFVQAQV 93
Fly 94 QQWISFADNEIVPASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKL---------QDATFLA 149
Fly 150 GERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWF--VTILNQKQVQAVVKDYKLCEKALVF 212
Fly 213 DPK-KYAEFQAKT 224 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
eEF1gamma | NP_001189308.1 | GST_N_EF1Bgamma | 4..79 | CDD:239342 | 17/45 (38%) |
GstA | 5..187 | CDD:223698 | 39/166 (23%) | ||
GST_C_EF1Bgamma_like | 90..209 | CDD:198290 | 23/129 (18%) | ||
EF1G | 271..376 | CDD:279041 | |||
gsto1 | NP_001002621.1 | GST_N_Omega | 4..93 | CDD:239353 | 17/44 (39%) |
GstA | 25..210 | CDD:223698 | 44/195 (23%) | ||
GST_C_Omega | 107..229 | CDD:198293 | 29/149 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |