DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and gsto1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001002621.1 Gene:gsto1 / 436894 ZFINID:ZDB-GENE-040718-365 Length:240 Species:Danio rerio


Alignment Length:208 Identity:49/208 - (23%)
Similarity:73/208 - (35%) Gaps:51/208 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGGKC----PFVQAQV 93
            |.......||...||:|.|.|.||..||..||.:.||......| :|.....|.    ||.:||.
Zfish    49 DTININLKNKPDWFLEKNPLGLVPVLETQSGQVIYESPITCEYL-DEVYPEKKLLPFDPFERAQQ 112

  Fly    94 QQWISFADNEIVPASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKL---------QDATFLA 149
            :..:.....         |.|....:|  .|.|..::..|:..:|..||         :.:.|..
Zfish   113 RMLLELFSK---------VTPYFYKIP--VNRTKGEDVSALETELKDKLSQFNEILLKKKSKFFG 166

  Fly   150 GERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWF--VTILNQKQVQAVVKDYKLCEKALVF 212
            |:.||:.|            |::.|           ||  :..:|.|.......:.|...:.::.
Zfish   167 GDSITMID------------YMMWP-----------WFERLETMNLKHCLDGTPELKKWTERMME 208

  Fly   213 DPK-KYAEFQAKT 224
            ||. |...|..:|
Zfish   209 DPTVKATMFSTET 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 17/45 (38%)
GstA 5..187 CDD:223698 39/166 (23%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 23/129 (18%)
EF1G 271..376 CDD:279041
gsto1NP_001002621.1 GST_N_Omega 4..93 CDD:239353 17/44 (39%)
GstA 25..210 CDD:223698 44/195 (23%)
GST_C_Omega 107..229 CDD:198293 29/149 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.