DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GstD11

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001138040.1 Gene:GstD11 / 41512 FlyBaseID:FBgn0038029 Length:243 Species:Drosophila melanogaster


Alignment Length:194 Identity:57/194 - (29%)
Similarity:86/194 - (44%) Gaps:27/194 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYTYPENFRAYKALIAAQYSGA--QVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSE 68
            ||..|.:......|:.|:....  ::|:. |...||..| .:|:...|...||.... ||..|.|
  Fly    27 LYYLPPSPPCRSILLLAKMLDIDFELKIV-NILEGEQLK-PDFVAMNPQHCVPTMND-EGLVLWE 88

  Fly    69 SNAI-AYLLA----NEQLRGGKCPF---VQAQVQQWISFADNEIVPASCAWVFPLLGI-LPQQKN 124
            |.|| :||:|    ::||    .|.   |:|.|.|.:.|....:......:.||.:.| .|..:.
  Fly    89 SRAILSYLVAAYGKSDQL----YPTDIRVRALVDQRLQFDLGTLYMRLTDYYFPTMFIGAPLDEG 149

  Fly   125 STAKQEAEAVLQQLNQKLQDATFLAGERITLAD--IVVFSSLLHLYEYVLEPSVRSAFGNVNRW 186
            ..||. |||| ..||..|:...|.|.:..|:||  ::|..|.|..:|:.|.|     :.::.:|
  Fly   150 KRAKL-AEAV-GWLNTILEGRQFSAADHFTIADLTLLVTVSQLEAFEFELRP-----YKHIRQW 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 24/79 (30%)
GstA 5..187 CDD:223698 57/194 (29%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 29/100 (29%)
EF1G 271..376 CDD:279041
GstD11NP_001138040.1 GST_N_Delta_Epsilon 25..98 CDD:239343 23/73 (32%)
GST_C_Delta_Epsilon 112..231 CDD:198287 30/102 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.