DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GstZ2

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_649895.1 Gene:GstZ2 / 41133 FlyBaseID:FBgn0037697 Length:227 Species:Drosophila melanogaster


Alignment Length:205 Identity:45/205 - (21%)
Similarity:83/205 - (40%) Gaps:33/205 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKGTLYTYPENFRAYKALIAAQYSGA--QVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQ 64
            ::..||:|..:..:::..||......  .:|.....|.|......|:.:..|..:|||.: .:|.
  Fly    14 IQPILYSYWRSSCSWRVRIAMNLKEIPYDIKPISLIKSGGEQHCNEYREVNPMEQVPALQ-IDGH 77

  Fly    65 YLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGIL------PQQK 123
            .|.||.||.:.|  |:.|..: |.:...|.:....  .|||...|:.:.||..::      .::|
  Fly    78 TLIESVAIMHYL--EETRPQR-PLLPQDVHKRAKV--REIVEIICSGIQPLQNLIVLIHVGEEKK 137

  Fly   124 NSTAKQEAEAVLQQLNQKLQDAT--FLAGERITLADIV----VFSSL-----LHLYEYVL----- 172
            ...|:.......:.:.:.|..:.  :..|:.|::||..    ||::.     |..|..:|     
  Fly   138 KEWAQHWITRGFRAVEKALSTSAGKYCVGDEISMADCCLVPQVFNARRFHVDLRPYPIILRIDRE 202

  Fly   173 ---EPSVRSA 179
               .|:.|:|
  Fly   203 LESNPAFRAA 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 20/76 (26%)
GstA 5..187 CDD:223698 45/202 (22%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 22/115 (19%)
EF1G 271..376 CDD:279041
GstZ2NP_649895.1 GST_N_Zeta 16..90 CDD:239340 20/76 (26%)
maiA 17..221 CDD:273527 45/202 (22%)
GST_C_Zeta 104..217 CDD:198300 21/111 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459961
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.