DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and trnt1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_989006.1 Gene:trnt1 / 394602 XenbaseID:XB-GENE-478054 Length:405 Species:Xenopus tropicalis


Alignment Length:133 Identity:24/133 - (18%)
Similarity:44/133 - (33%) Gaps:34/133 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   275 PFDALPKGTFNFDDFKRV------------------YSNEDEAKSIPYFFDKFDAENYSIWFGEY 321
            |...||||. |.::|.:|                  :||.|..:::.... |...|..::.....
 Frog   236 PHVGLPKGG-NLEEFAKVCERSHRMSPKPMTLLTALFSNTDHVQNLDLRL-KISKEEKNLALFLL 298

  Fly   322 KYNEELSKVFMSCNLITGMFQRLDKMRKAAFASVCLFGE--DGNSTISGIWVWRGQDLAFTLSPD 384
            :...||:.            :|.|......|....:...  |.:..||.:..::|::..|.....
 Frog   299 QQRRELTA------------ERTDAAPLKPFKDYVVDSREPDAHKKISELLKYQGEEQLFREMEG 351

  Fly   385 WQI 387
            |.:
 Frog   352 WTL 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342
GstA 5..187 CDD:223698
GST_C_EF1Bgamma_like 90..209 CDD:198290
EF1G 271..376 CDD:279041 22/120 (18%)
trnt1NP_989006.1 PcnB 11..405 CDD:223690 24/133 (18%)
NT_ClassII-CCAase 13..149 CDD:143388
PolyA_pol_RNAbd 190..241 CDD:289399 1/4 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.