DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and gstt1b

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_956878.1 Gene:gstt1b / 393556 ZFINID:ZDB-GENE-040426-1491 Length:242 Species:Danio rerio


Alignment Length:234 Identity:58/234 - (24%)
Similarity:101/234 - (43%) Gaps:58/234 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQY-LSESNAIAYLLANE------- 79
            |:...::.:.:.:::||.......|:|||..|       :|.: |:||.||...||::       
Zfish    27 QFDYKKISLFEGYQYGEEFGKINPLRKFPTIK-------DGDFCLAESVAIMIYLADKFHTPDHW 84

  Fly    80 -----QLRGGKCPFVQAQVQQWISFADNEI--VPASCAW---VFP-LLGI-LPQQKNSTAKQEAE 132
                 |.|        |:|.:::|:....|  ..|...|   :.| :||. :|::|...|::...
Zfish    85 FPADLQKR--------ARVNEYLSWQHTSIRMHGAKIIWFKILIPEVLGAEVPKEKMENAEENLN 141

  Fly   133 AVLQQLNQK-LQDATFLAGERITLADIVV-------FSSLLHLYE-----YVLEPSVRSAFGNVN 184
            ..||....| |||..|:.|::|:|||:|.       |::.:.::|     ...:..||.|.|   
Zfish   142 VALQLFQDKFLQDKPFIVGDQISLADLVAIVEIMQPFAAGMDVFENRPKLKAWKDRVRVAIG--- 203

  Fly   185 RWFVTILNQKQVQAVVKDYKLCEKALVFDPKKYAEFQAK 223
                ..|..:..||.:   .|.:.|.:.|||..:..:.|
Zfish   204 ----AKLFDEAHQATM---SLRDNAKIIDPKGLSPLKDK 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 16/56 (29%)
GstA 5..187 CDD:223698 49/196 (25%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 35/138 (25%)
EF1G 271..376 CDD:279041
gstt1bNP_956878.1 GstA 1..199 CDD:223698 45/186 (24%)
GST_N_Theta 3..78 CDD:239348 16/57 (28%)
GST_C_Theta 91..217 CDD:198292 35/143 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.