DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GstO2

DIOPT Version :10

Sequence 1:NP_652000.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:173 Identity:42/173 - (24%)
Similarity:62/173 - (35%) Gaps:33/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 WFVTILNQKQVQAV----VKDYKLCEKALVFDPKKYAEFQAKTGAAKPQQQAQQQKQEKKPKEKK 246
            |:.......:|.|:    |||.....::|:.     ||:       ..||..|.:.....|.:|.
  Fly    61 WYKDFSPLGKVPALQLTGVKDQPTLVESLII-----AEY-------LDQQYPQTRLFPTDPLQKA 113

  Fly   247 EAPKKAAEPAEELDAADEALAAEPKSKDPFDALPKGTFNFDDFKRVYSNEDEAKSIPYFFDK-FD 310
            .........|..:.|....|...|.:  |.||:|    ||::...|:..|...:..|||..: ..
  Fly   114 LDKILIERFAPVVSAIYPVLTCNPNA--PKDAIP----NFENALDVFEVELGKRGTPYFAGQHIG 172

  Fly   311 AENYSIW-----FGEYKYNEELSKVFMSCNLITGMFQRLDKMR 348
            ..:|.||     |...|.|.|     ....|.|..|::|.|.|
  Fly   173 IVDYMIWPWFERFPSMKINTE-----QKYELDTKRFEKLLKWR 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_652000.1 GST_N_EF1Bgamma 4..79 CDD:239342
GST_C_EF1Bgamma_like 90..209 CDD:198290 6/26 (23%)
EF1G 273..376 CDD:459888 24/82 (29%)
GstO2NP_729388.1 Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold 5..96 CDD:469754 9/46 (20%)
GST_C_Omega 110..235 CDD:198293 29/112 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.