DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GstO2

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_729388.1 Gene:GstO2 / 38974 FlyBaseID:FBgn0035906 Length:251 Species:Drosophila melanogaster


Alignment Length:173 Identity:42/173 - (24%)
Similarity:62/173 - (35%) Gaps:33/173 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 WFVTILNQKQVQAV----VKDYKLCEKALVFDPKKYAEFQAKTGAAKPQQQAQQQKQEKKPKEKK 246
            |:.......:|.|:    |||.....::|:.     ||:       ..||..|.:.....|.:|.
  Fly    61 WYKDFSPLGKVPALQLTGVKDQPTLVESLII-----AEY-------LDQQYPQTRLFPTDPLQKA 113

  Fly   247 EAPKKAAEPAEELDAADEALAAEPKSKDPFDALPKGTFNFDDFKRVYSNEDEAKSIPYFFDK-FD 310
            .........|..:.|....|...|.:  |.||:|    ||::...|:..|...:..|||..: ..
  Fly   114 LDKILIERFAPVVSAIYPVLTCNPNA--PKDAIP----NFENALDVFEVELGKRGTPYFAGQHIG 172

  Fly   311 AENYSIW-----FGEYKYNEELSKVFMSCNLITGMFQRLDKMR 348
            ..:|.||     |...|.|.|     ....|.|..|::|.|.|
  Fly   173 IVDYMIWPWFERFPSMKINTE-----QKYELDTKRFEKLLKWR 210

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342