DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and se

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:218 Identity:48/218 - (22%)
Similarity:71/218 - (32%) Gaps:73/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GTLYTYPENF-----RAYKALIAAQ--YSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETA 61
            |.|..|...|     |.:..|.|.|  |....:.:        |:|....|:|.|.|||||.|..
  Fly    20 GILRLYSMRFCPFAQRVHLVLDAKQIPYHSIYINL--------TDKPEWLLEKNPQGKVPALEIV 76

  Fly    62 E---GQYLSESNAIAYLLANEQLRGGKCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQK 123
            .   ...|:||..|             |.::..|                    :||..:.|:  
  Fly    77 REPGPPVLTESLLI-------------CEYLDEQ--------------------YPLRPLYPR-- 106

  Fly   124 NSTAKQEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWFV 188
             ...|:..:.:|.:..:.:..|.|.|.:.   .|:..|.|.|.:||..|.......||.      
  Fly   107 -DPLKKVQDKLLIERFRAVLGAFFKASDG---GDLEPFWSGLDIYERELARRGTEFFGG------ 161

  Fly   189 TILNQKQVQAVVKDYKL---CEK 208
                   .|..:.||.:   ||:
  Fly   162 -------EQTGILDYMIWPWCER 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 24/84 (29%)
GstA 5..187 CDD:223698 42/191 (22%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 23/122 (19%)
EF1G 271..376 CDD:279041
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 25/95 (26%)
GstA 22..215 CDD:223698 47/216 (22%)
GST_C_Omega 109..229 CDD:198293 19/85 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459932
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.