DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GstO3

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_648234.1 Gene:GstO3 / 38972 FlyBaseID:FBgn0035904 Length:241 Species:Drosophila melanogaster


Alignment Length:34 Identity:14/34 - (41%)
Similarity:15/34 - (44%) Gaps:7/34 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 DYEVYDWKKLDAKSEETKKLVTQYFSWSGTDKDG 421
            ||    |..||...||..|..|.||   |.:|.|
  Fly   140 DY----WTALDIFEEELTKRGTPYF---GGNKPG 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342
GstA 5..187 CDD:223698
GST_C_EF1Bgamma_like 90..209 CDD:198290
EF1G 271..376 CDD:279041
GstO3NP_648234.1 Thioredoxin_like 3..95 CDD:294274
GstA 22..209 CDD:223698 14/34 (41%)
GST_C_Omega 109..230 CDD:198293 14/34 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459933
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.