powered by:
Protein Alignment eEF1gamma and Gr59f
DIOPT Version :9
Sequence 1: | NP_001189308.1 |
Gene: | eEF1gamma / 44791 |
FlyBaseID: | FBgn0029176 |
Length: | 431 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_788432.1 |
Gene: | Gr59f / 37726 |
FlyBaseID: | FBgn0041234 |
Length: | 406 |
Species: | Drosophila melanogaster |
Alignment Length: | 43 |
Identity: | 14/43 - (32%) |
Similarity: | 19/43 - (44%) |
Gaps: | 3/43 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 144 DATFLAGERITLADIVVFSSLLHLYEYVLEPSVRSAFGNVNRW 186
|..||....:..||..:| |..|:...|...:|..|||.|:
Fly 366 DLKFLTTLLVASADFFIF---LLQYDVTYEALSKSVQGNVTRY 405
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0625 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.