DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GstE4

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:197 Identity:45/197 - (22%)
Similarity:84/197 - (42%) Gaps:46/197 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 FGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNAI-AYLL----ANEQLRGGKCPFVQAQVQQW 96
            |.:.|.|.:|.||.|...||..:. :...:.:|:|| |||:    .:::|. .|....:|:|.|.
  Fly    37 FEKENFSEDFSKKNPQHTVPLLQD-DDACIWDSHAIMAYLVEKYAPSDELY-PKDLLQRAKVDQL 99

  Fly    97 ISFADNEIVPASCAWVF-PLL----GILPQQKNSTAKQEAEAVLQQ---LNQKLQDATFLAGERI 153
            :.|....|..::...:. |:|    ..||       :.:.:.:||.   :...|.|..|:||:::
  Fly   100 MHFESGVIFESALRRLTRPVLFFGEPTLP-------RNQVDHILQVYDFVETFLDDHDFVAGDQL 157

  Fly   154 TLADIVVFSSLLHLYEYV-LEPSVRSAFGNVNRW--------------------FVTILNQKQVQ 197
            |:||..:.|::..:..:: |:|   :.:..:..|                    ||.:|..|...
  Fly   158 TIADFSIVSTITSIGVFLELDP---AKYPKIAAWLERLKELPYYEEANGKGAAQFVELLRSKNFT 219

  Fly   198 AV 199
            .|
  Fly   220 IV 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 15/46 (33%)
GstA 5..187 CDD:223698 40/183 (22%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 28/139 (20%)
EF1G 271..376 CDD:279041
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 15/40 (38%)
GstA 6..196 CDD:223698 40/170 (24%)
GST_C_Delta_Epsilon 91..209 CDD:198287 23/127 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459948
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.