DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GstE1

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_611323.1 Gene:GstE1 / 37106 FlyBaseID:FBgn0034335 Length:224 Species:Drosophila melanogaster


Alignment Length:230 Identity:59/230 - (25%)
Similarity:92/230 - (40%) Gaps:68/230 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGG----KCPFVQAQVQ 94
            |.:.|| :.|.|::||.|...||..:. .|.::.:|:|||..|.::..:..    |....:|.|.
  Fly    37 NLQAGE-HLSEEYVKKNPQHTVPMLDD-NGTFIWDSHAIAAYLVDKYAKSDELYPKDLAKRAIVN 99

  Fly    95 QWISFADNEIVPASCAWV---FPLLGI--LPQQKNSTAKQEAEAVLQQLNQKLQDATFLAGERIT 154
            |.: |.|..::.||.|.|   |.:.|:  :||:|.....|.    |:.|...|.::.:|||:.:|
  Fly   100 QRL-FFDASVIYASIANVSRPFWINGVTEVPQEKLDAVHQG----LKLLETFLGNSPYLAGDSLT 159

  Fly   155 LADIVVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVKDYKLCEKALVFDPKKYAE 219
            |||:..            .|:|.:                 |.|.|.          .||..|  
  Fly   160 LADLST------------GPTVSA-----------------VPAAVD----------IDPATY-- 183

  Fly   220 FQAKTGAAKPQQQAQQQKQEKKP--KEKKEAPKKA 252
                     |:..|...:..|.|  ||..|||.::
  Fly   184 ---------PKVTAWLDRLNKLPYYKEINEAPAQS 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 16/44 (36%)
GstA 5..187 CDD:223698 44/161 (27%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 30/123 (24%)
EF1G 271..376 CDD:279041
GstE1NP_611323.1 GST_N_Delta_Epsilon 6..79 CDD:239343 16/43 (37%)
GstA 8..197 CDD:223698 53/216 (25%)
GST_C_Delta_Epsilon 94..210 CDD:198287 42/171 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459955
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.