DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eEF1gamma and GstE10

DIOPT Version :9

Sequence 1:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:240 Identity:56/240 - (23%)
Similarity:91/240 - (37%) Gaps:64/240 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 QYSGAQVKVADNFKFGETNKSAEFLKKFPGGKVPAFETAEGQYLSESNAIAYLLANEQLRGG--- 84
            ::....::..|:.|       .:.|:|.|...||..|..| ..:.:|:||...|.|:..:..   
  Fly    30 EFHTLDMQAGDHLK-------PDMLRKNPQHTVPMLEDGE-SCIWDSHAIIGYLVNKYAQSDELY 86

  Fly    85 -KCPFVQAQVQQWISFADNEIVPASCAWVFPLLGILPQQKNSTAKQEAEAVLQQLNQKLQDA--- 145
             |.|..:|.|.|.:.|....:          ..||..|.:.:..|:.|..|.:....:|:||   
  Fly    87 PKDPLKRAVVDQRLHFETGVL----------FHGIFKQLQRALFKENATEVPKDRLAELKDAYAL 141

  Fly   146 --------TFLAGERITLAD--IVVFSSLLHLYEYVLEPSVRSAFGNVNRWFVTI---------- 190
                    .::||.::|:||  ||...|.||| .|.  |...:.:..::.|...|          
  Fly   142 LEQFLAENPYVAGPQLTIADFSIVATVSTLHL-SYC--PVDATKYPKLSAWLARISALPFYEEDN 203

  Fly   191 ------LNQKQVQAVVKDY-KLCEKALVFDPKKYAEFQAKTGAAK 228
                  |..|....:.|.: ||.:||  |:       ..|:||.|
  Fly   204 LRGARLLADKIRSKLPKQFDKLWQKA--FE-------DIKSGAGK 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 13/55 (24%)
GstA 5..187 CDD:223698 42/180 (23%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 33/148 (22%)
EF1G 271..376 CDD:279041
GstE10NP_001286570.1 GstA 4..197 CDD:223698 44/187 (24%)
GST_N_Delta_Epsilon 4..77 CDD:239343 13/54 (24%)
GST_C_Delta_Epsilon 91..211 CDD:198287 28/132 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459946
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.